PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cotton_A_39554_BGI-A2_v1.0
Common NameF383_12791
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family SBP
Protein Properties Length: 372aa    MW: 40079.6 Da    PI: 9.1613
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cotton_A_39554_BGI-A2_v1.0genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP135.22.1e-4278153176
                                 --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S- CS
                         SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkk 76 
                                 +CqvegC++dl++ak y++rhkvC +hska++v+v+gleqrfCqqCsrfh+l efD++krsCrrrLa+hnerrrk+
  Cotton_A_39554_BGI-A2_v1.0  78 RCQVEGCKVDLTDAKAYYSRHKVCGMHSKAANVIVAGLEQRFCQQCSRFHQLPEFDQRKRSCRRRLAGHNERRRKP 153
                                 6*************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.4E-3472140IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.05276153IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.62E-4077157IPR004333Transcription factor, SBP-box
PfamPF031105.4E-3279152IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0048653Biological Processanther development
GO:2000025Biological Processregulation of leaf formation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 372 aa     Download sequence    Send to blast
MGSGSLTDSG GSSSNSSTES LNGLKFGQKI YFEDTSAAGT GGGTTMGTPL KSGIGSSSSS  60
GSGKKARGGV VQGGQPPRCQ VEGCKVDLTD AKAYYSRHKV CGMHSKAANV IVAGLEQRFC  120
QQCSRFHQLP EFDQRKRSCR RRLAGHNERR RKPPPGSLLS SRYIRLSSSI IESSRGGSFI  180
MDFTAYPRLS RRDVWLTSRS SEHVPGNQYT GTGWLLPHPC QNNSENPPPN LYRQELPGGT  240
GVPSGRIPPG ECFTGVVDSN CALSLLSNQP RGSRNQGLTL GLNDMINSEL CSMSQPAMPH  300
GAVTNPYSNA SWGFKGNHSC SRSQDMLPQI PEPINSQLTG GLQLSHQSRG QYMEHEPSNA  360
DDTSMQHIHQ SF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A9e-32791521184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1134151RKRSCRRRLAGHNERRRK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00307DAPTransfer from AT2G42200Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ6223120.0KJ622312.1 Gossypium hirsutum SQUAMOSA promoter binding-like transcription factor (SPL4) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012467002.10.0PREDICTED: squamosa promoter-binding-like protein 9
TrEMBLA0A0B0PPS00.0A0A0B0PPS0_G
STRINGVIT_08s0007g06270.t011e-142(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM21442775
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42200.15e-52squamosa promoter binding protein-like 9